PDB entry 2af0

View 2af0 on RCSB PDB site
Description: Structure of the Regulator of G-Protein Signaling Domain of RGS2
Class: signaling protein
Keywords: HELIX, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2005-07-25, released 2005-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.227
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulator of G-protein signaling 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41220 (13-145)
      • cloning artifact (0-12)
    Domains in SCOPe 2.07: d2af0a1, d2af0a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2af0A (A:)
    adlgtenlyfqsmkpspeeaqlwseafdellaskyglaafraflksefceeniefwlace
    dfkktkspqklsskarkiytdfiekeapkeinidfqtktliaqniqeatsgcfttaqkrv
    yslmennsyprflesefyqdlckkpq