PDB entry 2af0

View 2af0 on RCSB PDB site
Description: Structure of the Regulator of G-Protein Signaling Domain of RGS2
Class: signaling protein
Keywords: HELIX, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2005-07-25, released 2005-08-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.227
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Regulator of G-protein signaling 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41220 (13-145)
    • cloning artifact (0-12)
  Domains in SCOPe 2.03: d2af0a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2af0A (A:)
  adlgtenlyfqsmkpspeeaqlwseafdellaskyglaafraflksefceeniefwlace
  dfkktkspqklsskarkiytdfiekeapkeinidfqtktliaqniqeatsgcfttaqkrv
  yslmennsyprflesefyqdlckkpq