PDB entry 2aen

View 2aen on RCSB PDB site
Description: Crystal structure of the rotavirus strain DS-1 VP8* core
Class: viral protein
Keywords: Rotavirus; VP4; VP8*; Neutralization antigen; Spike protein, VIRAL PROTEIN
Deposited on 2005-07-22, released 2006-02-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.16
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer capsid protein VP4, VP8* core
    Species: Rotavirus A [TaxId:10941]
    Gene: GENOME SEGEMENT 4
    Database cross-references and differences (RAF-indexed):
    • GB ABA18723 (0-163)
    Domains in SCOPe 2.05: d2aena_
  • Chain 'B':
    Compound: Outer capsid protein VP4, VP8* core
    Species: Rotavirus A [TaxId:10941]
    Gene: GENOME SEGEMENT 4
    Database cross-references and differences (RAF-indexed):
    • GB ABA18723 (0-163)
    Domains in SCOPe 2.05: d2aenb_
  • Chain 'C':
    Compound: Outer capsid protein VP4, VP8* core
    Species: Rotavirus A [TaxId:10941]
    Gene: GENOME SEGEMENT 4
    Database cross-references and differences (RAF-indexed):
    • GB ABA18723 (0-163)
    Domains in SCOPe 2.05: d2aenc_
  • Chain 'D':
    Compound: Outer capsid protein VP4, VP8* core
    Species: Rotavirus A [TaxId:10941]
    Gene: GENOME SEGEMENT 4
    Database cross-references and differences (RAF-indexed):
    • GB ABA18723 (0-163)
    Domains in SCOPe 2.05: d2aend_
  • Chain 'E':
    Compound: Outer capsid protein VP4, VP8* core
    Species: Rotavirus A [TaxId:10941]
    Gene: GENOME SEGEMENT 4
    Database cross-references and differences (RAF-indexed):
    • GB ABA18723 (0-163)
    Domains in SCOPe 2.05: d2aene_
  • Chain 'F':
    Compound: Outer capsid protein VP4, VP8* core
    Species: Rotavirus A [TaxId:10941]
    Gene: GENOME SEGEMENT 4
    Database cross-references and differences (RAF-indexed):
    • GB ABA18723 (0-163)
    Domains in SCOPe 2.05: d2aenf_
  • Chain 'G':
    Compound: Outer capsid protein VP4, VP8* core
    Species: Rotavirus A [TaxId:10941]
    Gene: GENOME SEGEMENT 4
    Database cross-references and differences (RAF-indexed):
    • GB ABA18723 (0-163)
    Domains in SCOPe 2.05: d2aeng_
  • Chain 'H':
    Compound: Outer capsid protein VP4, VP8* core
    Species: Rotavirus A [TaxId:10941]
    Gene: GENOME SEGEMENT 4
    Database cross-references and differences (RAF-indexed):
    • GB ABA18723 (0-163)
    Domains in SCOPe 2.05: d2aenh_
  • Heterogens: GOL, EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aenA (A:)
    tvepvldgpyqpttfkppndywllissntngvvyestnnndfwtaviavephvsqtnrqy
    ilfgenkqfnvennsdkwkffemfkgssqgdfsnrrtltssnrlvgmlkyggrvwtfhge
    tprattdssntadlnnisiiihsefyiiprsqeskcneyinngl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aenB (B:)
    tvepvldgpyqpttfkppndywllissntngvvyestnnndfwtaviavephvsqtnrqy
    ilfgenkqfnvennsdkwkffemfkgssqgdfsnrrtltssnrlvgmlkyggrvwtfhge
    tprattdssntadlnnisiiihsefyiiprsqeskcneyinngl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aenC (C:)
    tvepvldgpyqpttfkppndywllissntngvvyestnnndfwtaviavephvsqtnrqy
    ilfgenkqfnvennsdkwkffemfkgssqgdfsnrrtltssnrlvgmlkyggrvwtfhge
    tprattdssntadlnnisiiihsefyiiprsqeskcneyinngl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aenD (D:)
    tvepvldgpyqpttfkppndywllissntngvvyestnnndfwtaviavephvsqtnrqy
    ilfgenkqfnvennsdkwkffemfkgssqgdfsnrrtltssnrlvgmlkyggrvwtfhge
    tprattdssntadlnnisiiihsefyiiprsqeskcneyinngl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aenE (E:)
    tvepvldgpyqpttfkppndywllissntngvvyestnnndfwtaviavephvsqtnrqy
    ilfgenkqfnvennsdkwkffemfkgssqgdfsnrrtltssnrlvgmlkyggrvwtfhge
    tprattdssntadlnnisiiihsefyiiprsqeskcneyinngl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aenF (F:)
    tvepvldgpyqpttfkppndywllissntngvvyestnnndfwtaviavephvsqtnrqy
    ilfgenkqfnvennsdkwkffemfkgssqgdfsnrrtltssnrlvgmlkyggrvwtfhge
    tprattdssntadlnnisiiihsefyiiprsqeskcneyinngl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aenG (G:)
    tvepvldgpyqpttfkppndywllissntngvvyestnnndfwtaviavephvsqtnrqy
    ilfgenkqfnvennsdkwkffemfkgssqgdfsnrrtltssnrlvgmlkyggrvwtfhge
    tprattdssntadlnnisiiihsefyiiprsqeskcneyinngl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aenH (H:)
    tvepvldgpyqpttfkppndywllissntngvvyestnnndfwtaviavephvsqtnrqy
    ilfgenkqfnvennsdkwkffemfkgssqgdfsnrrtltssnrlvgmlkyggrvwtfhge
    tprattdssntadlnnisiiihsefyiiprsqeskcneyinngl