PDB entry 2aem

View 2aem on RCSB PDB site
Description: Crystal Structures of the MthK RCK Domain
Class: metal transport, membrane protein
Keywords: Rossmann fold, helix-turn-helix, METAL TRANSPORT, MEMBRANE PROTEIN
Deposited on 2005-07-22, released 2005-10-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.224
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium-gated potassium channel mthK
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: mthK
    Database cross-references and differences (RAF-indexed):
    • Uniprot O27564 (Start-229)
      • cloning artifact (230-231)
    Domains in SCOPe 2.08: d2aema1, d2aema2, d2aema3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aemA (A:)
    mglidvaksrhvvicgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptr
    vsdlekanvrgaravivdlesdsetihcilgirkidesvriiaeaeryenieqlrmagad
    qvispfvisgrlmsrsiddgyeamfvqdvlaeestrrmvevpipegsklegvsvldadih
    dvtgviiigvgrgdeliidpprdysfragdiilgigkpeeierlknyisalvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aemA (A:)
    aksrhvvicgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlek
    anvrgaravivdlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispf
    visgrlmsrsiddgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgvi
    iigvgrgdeliidpprdysfragdiilgigkpeeierlknyisalv