PDB entry 2aeh

View 2aeh on RCSB PDB site
Description: Focal adhesion kinase 1
Class: transferase
Keywords: FERM domain
Deposited on 2005-07-22, released 2005-10-18
The last revision prior to the SCOP 1.75 freeze date was dated 2006-01-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: 0.206
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Focal adhesion kinase 1
    Species: GALLUS GALLUS
    Gene: FAK1, FAK
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2aeha1, d2aeha2, d2aeha3
  • Chain 'B':
    Compound: Focal adhesion kinase 1
    Species: GALLUS GALLUS
    Gene: FAK1, FAK
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2aehb1, d2aehb2, d2aehb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aehA (A:)
    gamervlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrlshl
    qseevhwlhldmgvsnvrekfelahppeewkyelrirylpkgflnqftedkptlnffyqq
    vkndymleiadqvdqeialklgcleirrsygemrgnalekksnyevlekdvglrrffpks
    lldsvkaktlrkliqqtfrqfanlnreesilkffeilspvyrfdkecfkcalgsswiisv
    elaigpeegisyltdkganpthladfnqvqtiqysnsedkdrkgmlqlkiagapepltvt
    apsltiaenmadlidgycrlvngatqsfiirpqkegeralpsipklannekqgvrshtvs
    vsetddyae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aehA (A:)
    mervlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrlshlqs
    eevhwlhldmgvsnvrekfelahppeewkyelrirylpkgflnqftedkptlnffyqqvk
    ndymleiadqvdqeialklgcleirrsygemrgnalekksnyevlekdvglrrffpksll
    dsvkaktlrkliqqtfrqfanlnreesilkffeilspvyrfdkecfkcalgsswiisvel
    aigpeegisyltdkganpthladfnqvqtiqysnsedkdrkgmlqlkiagapepltvtap
    sltiaenmadlidgycrlvngatqsfiirpq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aehB (B:)
    gamervlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrlshl
    qseevhwlhldmgvsnvrekfelahppeewkyelrirylpkgflnqftedkptlnffyqq
    vkndymleiadqvdqeialklgcleirrsygemrgnalekksnyevlekdvglrrffpks
    lldsvkaktlrkliqqtfrqfanlnreesilkffeilspvyrfdkecfkcalgsswiisv
    elaigpeegisyltdkganpthladfnqvqtiqysnsedkdrkgmlqlkiagapepltvt
    apsltiaenmadlidgycrlvngatqsfiirpqkegeralpsipklannekqgvrshtvs
    vsetddyae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aehB (B:)
    mervlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrlshlqs
    eevhwlhldmgvsnvrekfelahppeewkyelrirylpkgflnqftedkptlnffyqqvk
    ndymleiadqvdqeialklgcleirrsygemrgnalekksnyevlekdvglrrffpksll
    dsvkaktlrkliqqtfrqfanlnreesilkffeilspvyrfdkecfkcalgsswiisvel
    aigpeegisyltdkganpthladfnqvqtiqysnsedkdrkgmlqlkiagapepltvtap
    sltiaenmadlidgycrlvngatqsfiirpq