PDB entry 2aea

View 2aea on RCSB PDB site
Description: X-Ray Structure of Protein from Arabidopsis Thaliana AT4G34215
Class: structural genomics, unknown function
Keywords: AT4G34215, Putative Acetylxylan Esterase, STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, Center for Eukaryotic Structural Genomics, CESG
Deposited on 2005-07-21, released 2005-08-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2005-08-30, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: 0.196
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative Acetylxylan Esterase
    Species: Arabidopsis thaliana
    Gene: AT4G34215
    Database cross-references and differences (RAF-indexed):
    • GB NP_567960 (Start-259)
      • modified residue (30)
    Domains in SCOPe 2.06: d2aeaa_
  • Chain 'B':
    Compound: Putative Acetylxylan Esterase
    Species: Arabidopsis thaliana
    Gene: AT4G34215
    Database cross-references and differences (RAF-indexed):
    • GB NP_567960 (Start-259)
      • modified residue (30)
    Domains in SCOPe 2.06: d2aeab_
  • Chain 'C':
    Compound: Putative Acetylxylan Esterase
    Species: Arabidopsis thaliana
    Gene: AT4G34215
    Database cross-references and differences (RAF-indexed):
    • GB NP_567960 (Start-259)
      • modified residue (30)
    Domains in SCOPe 2.06: d2aeac_
  • Chain 'D':
    Compound: Putative Acetylxylan Esterase
    Species: Arabidopsis thaliana
    Gene: AT4G34215
    Database cross-references and differences (RAF-indexed):
    • GB NP_567960 (Start-259)
      • modified residue (30)
    Domains in SCOPe 2.06: d2aead_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aeaA (A:)
    meggsitpgedkpeiqspippnqifilsgqsnmagrggvfkdhhnnrwvwdkilppecap
    nssilrlsadlrweeaheplhvdidtgkvcgvgpgmafanavknrletdsaviglvpcas
    ggtaikewergshlyermvkrteesrkcggeikavlwyqgesdvldihdaesygnnmdrl
    iknlrhdlnlpslpiiqvaiasgggyidkvreaqlglklsnvvcvdakglplksdnlhlt
    teaqvqlglslaqaylsnfc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aeaA (A:)
    spippnqifilsgqsnmagrggvfkdhhnnrwvwdkilppecapnssilrlsadlrweea
    heplhvdidtgkvcgvgpgmafanavknrletdsaviglvpcasggtaikewergshlye
    rmvkrteesrkcggeikavlwyqgesdvldihdaesygnnmdrliknlrhdlnlpslpii
    qvaiasgggyidkvreaqlglklsnvvcvdakglplksdnlhltteaqvqlglslaqayl
    snfc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aeaB (B:)
    meggsitpgedkpeiqspippnqifilsgqsnmagrggvfkdhhnnrwvwdkilppecap
    nssilrlsadlrweeaheplhvdidtgkvcgvgpgmafanavknrletdsaviglvpcas
    ggtaikewergshlyermvkrteesrkcggeikavlwyqgesdvldihdaesygnnmdrl
    iknlrhdlnlpslpiiqvaiasgggyidkvreaqlglklsnvvcvdakglplksdnlhlt
    teaqvqlglslaqaylsnfc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aeaB (B:)
    spippnqifilsgqsnmagrggvfkdhhnnrwvwdkilppecapnssilrlsadlrweea
    heplhvdidtgkvcgvgpgmafanavknrletdsaviglvpcasggtaikewergshlye
    rmvkrteesrkcggeikavlwyqgesdvldihdaesygnnmdrliknlrhdlnlpslpii
    qvaiasgggyidkvreaqlglklsnvvcvdakglplksdnlhltteaqvqlglslaqayl
    snfc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2aeaC (C:)
    meggsitpgedkpeiqspippnqifilsgqsnmagrggvfkdhhnnrwvwdkilppecap
    nssilrlsadlrweeaheplhvdidtgkvcgvgpgmafanavknrletdsaviglvpcas
    ggtaikewergshlyermvkrteesrkcggeikavlwyqgesdvldihdaesygnnmdrl
    iknlrhdlnlpslpiiqvaiasgggyidkvreaqlglklsnvvcvdakglplksdnlhlt
    teaqvqlglslaqaylsnfc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aeaC (C:)
    spippnqifilsgqsnmagrggvfkdhhnnrwvwdkilppecapnssilrlsadlrweea
    heplhvdidtgkvcgvgpgmafanavknrletdsaviglvpcasggtaikewergshlye
    rmvkrteesrkcggeikavlwyqgesdvldihdaesygnnmdrliknlrhdlnlpslpii
    qvaiasgggyidkvreaqlglklsnvvcvdakglplksdnlhltteaqvqlglslaqayl
    snfc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2aeaD (D:)
    meggsitpgedkpeiqspippnqifilsgqsnmagrggvfkdhhnnrwvwdkilppecap
    nssilrlsadlrweeaheplhvdidtgkvcgvgpgmafanavknrletdsaviglvpcas
    ggtaikewergshlyermvkrteesrkcggeikavlwyqgesdvldihdaesygnnmdrl
    iknlrhdlnlpslpiiqvaiasgggyidkvreaqlglklsnvvcvdakglplksdnlhlt
    teaqvqlglslaqaylsnfc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aeaD (D:)
    ppnqifilsgqsnmagrggvvwdkilppecapnssilrlsadlrweeaheplhvdidtgk
    vcgvgpgmafanavkviglvpcasggtaikewergshlyermvkrteesrkcggeikavl
    wyqgesdvldihdaesygnnmdrliknlrhdlnlpslpiiqvaiasgggyidkvreaqlg
    lklsnvvcvdakglplksdnlhltteaqvqlglslaqaylsnfc