PDB entry 2ae9

View 2ae9 on RCSB PDB site
Description: Solution Structure of the theta subunit of DNA polymerase III from E. coli
Class: transferase
Keywords: all helical, 3 helices
Deposited on 2005-07-21, released 2005-10-18
The last revision prior to the SCOP 1.73 freeze date was dated 2005-10-18, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase III, theta subunit
    Species: Escherichia coli
    Gene: holE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ae9a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ae9A (A:)
mlknlakldqtemdkvnvdlaaagvafkerynmpviaeavereqpehlrswfrerliahr
lasvnlsrlpyepklk