PDB entry 2ae8

View 2ae8 on RCSB PDB site
Description: Crystal Structure of Imidazoleglycerol-phosphate Dehydratase from Staphylococcus aureus subsp. aureus N315
Class: lyase
Keywords: beta-alpha-beta sandwich, duplication of a half-domain, imidazoleglycerol-phosphate dehydratase (IGPD), Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, LYASE
Deposited on 2005-07-21, released 2005-09-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-20, with a file datestamp of 2015-05-15.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Imidazoleglycerol-phosphate dehydratase
    Species: Staphylococcus aureus [TaxId:158879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ae8a1, d2ae8a2
  • Chain 'B':
    Compound: Imidazoleglycerol-phosphate dehydratase
    Species: Staphylococcus aureus [TaxId:158879]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P64373 (29-End)
      • cloning artifact (28)
    Domains in SCOPe 2.07: d2ae8b1, d2ae8b2, d2ae8b3
  • Chain 'C':
    Compound: Imidazoleglycerol-phosphate dehydratase
    Species: Staphylococcus aureus [TaxId:158879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ae8c1, d2ae8c2
  • Chain 'D':
    Compound: Imidazoleglycerol-phosphate dehydratase
    Species: Staphylococcus aureus [TaxId:158879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ae8d1, d2ae8d2
  • Chain 'E':
    Compound: Imidazoleglycerol-phosphate dehydratase
    Species: Staphylococcus aureus [TaxId:158879]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P64373 (29-End)
      • cloning artifact (28)
    Domains in SCOPe 2.07: d2ae8e1, d2ae8e2, d2ae8e3
  • Chain 'F':
    Compound: Imidazoleglycerol-phosphate dehydratase
    Species: Staphylococcus aureus [TaxId:158879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ae8f1, d2ae8f2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ae8A (A:)
    hhhhhhssgvdlgtenlyfqsnigsgsnamiyqkqrntaetqlnisisddqspshintgv
    gflnhmltlftfhsglslnieaqgdidvddhhvtedigivigqlllemikdkkhfvrygt
    myipmdetlarvvvdisgrpylsfnaslskekvgtfdtelveeffravvinarltthidl
    irggnthheieaifkafsralgialtatddqrvpsskgvie
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ae8A (A:)
    miyqkqrtqlnisisddqspshintgvgflnhmltlftfhsglslnieaqgddhhvtedi
    givigqlllemikdkkhfvrygtmyipmdetlarvvvdisgrpylsfnaslskekvgtfd
    telveeffravvinarltthidlirggnthheieaifkafsralgialtat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ae8B (B:)
    hhhhhhssgvdlgtenlyfqsnigsgsnamiyqkqrntaetqlnisisddqspshintgv
    gflnhmltlftfhsglslnieaqgdidvddhhvtedigivigqlllemikdkkhfvrygt
    myipmdetlarvvvdisgrpylsfnaslskekvgtfdtelveeffravvinarltthidl
    irggnthheieaifkafsralgialtatddqrvpsskgvie
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ae8B (B:)
    amiyqkqrnqlnisisddqspshintgvgflnhmltlftfhsglslnieaqgddhhvted
    igivigqlllemikdkkhfvrygtmyipmdetlarvvvdisgrpylsfnaslskekvgtf
    dtelveeffravvinarltthidlirggnthheieaifkafsralgialtat
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ae8C (C:)
    hhhhhhssgvdlgtenlyfqsnigsgsnamiyqkqrntaetqlnisisddqspshintgv
    gflnhmltlftfhsglslnieaqgdidvddhhvtedigivigqlllemikdkkhfvrygt
    myipmdetlarvvvdisgrpylsfnaslskekvgtfdtelveeffravvinarltthidl
    irggnthheieaifkafsralgialtatddqrvpsskgvie
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ae8C (C:)
    miyqkqrtqlnisisddqspshintgvgflnhmltlftfhsglslnieaqgddhhvtedi
    givigqlllemikdkkhfvrygtmyipmdetlarvvvdisgrpylsfnaslskekvgtfd
    telveeffravvinarltthidlirggnthheieaifkafsralgialtat
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ae8D (D:)
    hhhhhhssgvdlgtenlyfqsnigsgsnamiyqkqrntaetqlnisisddqspshintgv
    gflnhmltlftfhsglslnieaqgdidvddhhvtedigivigqlllemikdkkhfvrygt
    myipmdetlarvvvdisgrpylsfnaslskekvgtfdtelveeffravvinarltthidl
    irggnthheieaifkafsralgialtatddqrvpsskgvie
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ae8D (D:)
    miyqkqrnqlnisisddqspshintgvgflnhmltlftfhsglslnieaqgddhhvtedi
    givigqlllemikdkkhfvrygtmyipmdetlarvvvdisgrpylsfnaslskekvgtfd
    telveeffravvinarltthidlirggnthheieaifkafsralgialtat
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ae8E (E:)
    hhhhhhssgvdlgtenlyfqsnigsgsnamiyqkqrntaetqlnisisddqspshintgv
    gflnhmltlftfhsglslnieaqgdidvddhhvtedigivigqlllemikdkkhfvrygt
    myipmdetlarvvvdisgrpylsfnaslskekvgtfdtelveeffravvinarltthidl
    irggnthheieaifkafsralgialtatddqrvpsskgvie
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ae8E (E:)
    amiyqkqrnqlnisisddqspshintgvgflnhmltlftfhsglslnieaqddhhvtedi
    givigqlllemikdkkhfvrygtmyipmdetlarvvvdisgrpylsfnaslskekvgtfd
    telveeffravvinarltthidlirggnthheieaifkafsralgialtat
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ae8F (F:)
    hhhhhhssgvdlgtenlyfqsnigsgsnamiyqkqrntaetqlnisisddqspshintgv
    gflnhmltlftfhsglslnieaqgdidvddhhvtedigivigqlllemikdkkhfvrygt
    myipmdetlarvvvdisgrpylsfnaslskekvgtfdtelveeffravvinarltthidl
    irggnthheieaifkafsralgialtatddqrvpsskgvie
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ae8F (F:)
    miyqkqrtqlnisisddqspshintgvgflnhmltlftfhsglslnieaqgdhhvtedig
    ivigqlllemikdkkhfvrygtmyipmdetlarvvvdisgrpylsfnaslskekvgtfdt
    elveeffravvinarltthidlirggnthheieaifkafsralgialtat