PDB entry 2ae6

View 2ae6 on RCSB PDB site
Description: Crystal Structure of Acetyltransferase of GNAT family from Enterococcus faecalis V583
Class: transferase
Keywords: GCN5-related N-acetyltransferase (GNAT), alpha-beta, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSFERASE
Deposited on 2005-07-21, released 2005-09-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.215
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyltransferase, GNAT family
    Species: Enterococcus faecalis [TaxId:226185]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q839D1 (3-End)
      • modified residue (3)
      • modified residue (49)
      • modified residue (108)
      • modified residue (122)
    Domains in SCOPe 2.08: d2ae6a1
  • Chain 'B':
    Compound: acetyltransferase, GNAT family
    Species: Enterococcus faecalis [TaxId:226185]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q839D1 (3-End)
      • modified residue (3)
      • modified residue (49)
      • modified residue (108)
      • modified residue (122)
    Domains in SCOPe 2.08: d2ae6b_
  • Chain 'C':
    Compound: acetyltransferase, GNAT family
    Species: Enterococcus faecalis [TaxId:226185]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q839D1
      • modified residue (49)
      • modified residue (108)
      • modified residue (122)
    Domains in SCOPe 2.08: d2ae6c_
  • Chain 'D':
    Compound: acetyltransferase, GNAT family
    Species: Enterococcus faecalis [TaxId:226185]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q839D1
      • modified residue (49)
      • modified residue (108)
      • modified residue (122)
    Domains in SCOPe 2.08: d2ae6d_
  • Heterogens: MG, GOL, EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ae6A (A:)
    snamstsltirlvaeadwpalhaldqiiwtkkntpaeiqplslaayqekmkdetifvais
    gqqlagfievhpptslaahqkqwllsigvspdfqdqgiggsllsyikdmaeisgihklsl
    rvmatnqeairfyekhgfvqeahfkeefyinghycddyqyayfiek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ae6A (A:)
    mstsltirlvaeadwpalhaldqiislaayqekmkdetifvaisgqqlagfievhpptsl
    aahqkqwllsigvspdfqdqgiggsllsyikdmaeisgihklslrvmatnqeairfyekh
    gfvqeahfkeefyinghycddyqyayfi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ae6B (B:)
    snamstsltirlvaeadwpalhaldqiiwtkkntpaeiqplslaayqekmkdetifvais
    gqqlagfievhpptslaahqkqwllsigvspdfqdqgiggsllsyikdmaeisgihklsl
    rvmatnqeairfyekhgfvqeahfkeefyinghycddyqyayfiek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ae6B (B:)
    mstsltirlvaeadwpalhaldqiilaayqekmkdetifvaisgqqlagfievhpptsla
    ahqkqwllsigvspdfqdqgiggsllsyikdmaeisgihklslrvmatnqeairfyekhg
    fvqeahfkeefyinghycddyqyayfi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ae6C (C:)
    snamstsltirlvaeadwpalhaldqiiwtkkntpaeiqplslaayqekmkdetifvais
    gqqlagfievhpptslaahqkqwllsigvspdfqdqgiggsllsyikdmaeisgihklsl
    rvmatnqeairfyekhgfvqeahfkeefyinghycddyqyayfiek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ae6C (C:)
    sltirlvaeadwpalhaldqiislaayqekmkdetifvaisgqqlagfievhpptslaah
    qkqwllsigvspdfqdqgiggsllsyikdmaeisgihklslrvmatnqeairfyekhgfv
    qeahfkeefyinghycddyqyayfi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ae6D (D:)
    snamstsltirlvaeadwpalhaldqiiwtkkntpaeiqplslaayqekmkdetifvais
    gqqlagfievhpptslaahqkqwllsigvspdfqdqgiggsllsyikdmaeisgihklsl
    rvmatnqeairfyekhgfvqeahfkeefyinghycddyqyayfiek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ae6D (D:)
    ltirlvaeadwpalhaldqiislaayqekmkdetifvaisgqqlagfievhpptslaahq
    kqwllsigvspdfqdqgiggsllsyikdmaeisgihklslrvmatnqeairfyekhgfvq
    eahfkeefyinghycddyqyayfi