PDB entry 2adz

View 2adz on RCSB PDB site
Description: solution structure of the joined PH domain of alpha1-syntrophin
Class: protein binding
Keywords: protein binding
Deposited on 2005-07-21, released 2006-01-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -3.99 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-1-syntrophin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2adza1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2adzA (A:)
asgrraprtgllelrcgagsgaggerwqrvllslaedaltvspadgepgpepepaqlnga
aepgaappqlpealllqrevspyfknsaggtsvgwdsppasplqrqpsspgpqprnlsea
khvslkmayvsrrctptdpepryleicaadgqdavflrakdeasarswagaiqaqigt