PDB entry 2adm

View 2adm on RCSB PDB site
Description: adenine-n6-DNA-methyltransferase taqi
Class: methyltransferase
Keywords: transferase, methyltransferase, restriction system
Deposited on 1996-07-15, released 1997-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.214
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenine-n6-DNA-methyltransferase taqi
    Species: Thermus aquaticus [TaxId:271]
    Gene: TAQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14385
      • conflict (369)
    Domains in SCOPe 2.07: d2adma1, d2adma2
  • Chain 'B':
    Compound: adenine-n6-DNA-methyltransferase taqi
    Species: Thermus aquaticus [TaxId:271]
    Gene: TAQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14385
      • conflict (369)
    Domains in SCOPe 2.07: d2admb1, d2admb2
  • Heterogens: SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2admA (A:)
    mglppllslpsnsaprslgrvetppevvdfmvslaeaprggrvlepacahgpflrafrea
    hgtgyrfvgveidpkaldlppwaegiladfllwepgeafdlilgnppygivgeaskypih
    vfkavkdlykkafstwkgkynlygaflekavrllkpggvlvfvvpatwlvledfallref
    laregktsvyylgevfpqkkvsavvirfqksgkglslwdtqesesgftpilwaeyphweg
    eiirfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkp
    gwvdyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllp
    kegvrldpstlvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfhtspesarn
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2admA (A:)
    vetppevvdfmvslaeaprggrvlepacahgpflrafreahgtgyrfvgveidpkaldlp
    pwaegiladfllwepgeafdlilgnppygivgvfkavkdlykkafstwkgkynlygafle
    kavrllkpggvlvfvvpatwlvledfallreflaregktsvyylgevfpqkkvsavvirf
    qksgkglslwdtqesesgftpilwaeyphwegeiirfeteetrkleisgmplgdlfhirf
    aarspefkkhpavrkepgpglvpvltgrnlkpgwvdyeknhsglwmpkerakelrdfyat
    phlvvahtkgtrvvaawderaypwreefhllpkegvrldpstlvqwlnseamqkhvrtly
    rdfvphltlrmlerlpvrreygfht
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2admB (B:)
    mglppllslpsnsaprslgrvetppevvdfmvslaeaprggrvlepacahgpflrafrea
    hgtgyrfvgveidpkaldlppwaegiladfllwepgeafdlilgnppygivgeaskypih
    vfkavkdlykkafstwkgkynlygaflekavrllkpggvlvfvvpatwlvledfallref
    laregktsvyylgevfpqkkvsavvirfqksgkglslwdtqesesgftpilwaeyphweg
    eiirfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkp
    gwvdyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllp
    kegvrldpstlvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfhtspesarn
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2admB (B:)
    vetppevvdfmvslaeaprggrvlepacahgpflrafreahgtgyrfvgveidpkaldlp
    pwaegiladfllwepgeafdlilgnppygivgvfkavkdlykkafstwkgkynlygafle
    kavrllkpggvlvfvvpatwlvledfallreflaregktsvyylgevfpqkkvsavvirf
    qksgkglslwdtqesesgftpilwaeyphwegeiirfeteetrkleisgmplgdlfhirf
    aarspefkkhpavrkepgpglvpvltgrnlkpgwvdyeknhsglwmpkerakelrdfyat
    phlvvahtkgtrvvaawderaypwreefhllpkegvrldpstlvqwlnseamqkhvrtly
    rdfvphltlrmlerlpvrreygfht