PDB entry 2adf

View 2adf on RCSB PDB site
Description: Crystal Structure and Paratope Determination of 82D6A3, an Antithrombotic Antibody Directed Against the von Willebrand factor A3-Domain
Class: blood clotting/immune system
Keywords: on Willebrand factor, A3-domain, 82D6A3, collagen binding, paratope, epitope, antithrombotic, BLOOD CLOTTING-IMMUNE SYSTEM COMPLEX
Deposited on 2005-07-20, released 2005-12-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: von willebrand factor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2adfa_
  • Chain 'H':
    Compound: 82D6A3 IgG
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2adfh1
  • Chain 'L':
    Compound: 82D6A3 IgG
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2adfl1, d2adfl2
  • Heterogens: SO4, ACY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2adfA (A:)
    gshmapdcsqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsi
    ttidvpwnvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvi
    lvtdvsvdsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlp
    tmvtlgnsflhklcsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2adfA (A:)
    dcsqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidvp
    wnvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdvs
    vdsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtlg
    nsflhklcs
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2adfH (H:)
    qiqlvqsgpelkkpgetvkisckasgytfinygmnwvkqapgkglkwmgwkntntgetty
    geefrgrfafsletsvstaylqinnlknedtatyfcardnpyyaldywgqgttvtvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2adfL (L:)
    diqmtqspsslsaslggkvtitckasqdinkyiawyqhkpgkgprllihytstlqpgips
    rfsgsgsgrdysfsisnlepediatyyclqydnlrtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfn