PDB entry 2adb

View 2adb on RCSB PDB site
Description: Solution structure of Polypyrimidine Tract Binding protein RBD2 complexed with CUCUCU RNA
Class: RNA binding protein/RNA
Keywords: RBD, RRM, Protein-RNA Complex
Deposited on 2005-07-20, released 2005-10-04
The last revision prior to the SCOP 1.73 freeze date was dated 2005-10-04, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polypyrimidine tract-binding protein 1
    Species: HOMO SAPIENS
    Gene: PTB-1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2adba1
  • Chain 'B':
    Compound: 5'-r(*cp*up*cp*up*cp*u)-3'
    Species: synthetic, synthetic

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2adbA (A:)
    mgsshhhhhhssglvprgshmdagmamagqspvlriivenlfypvtldvlhqifskfgtv
    lkiitftknnqfqallqyadpvsaqhaklsldgqniynacctlridfskltslnvkynnd
    ksrdytrpdlpsgdsqpsldqtmaaafg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2adbA (A:)
    dagmamagqspvlriivenlfypvtldvlhqifskfgtvlkiitftknnqfqallqyadp
    vsaqhaklsldgqniynacctlridfskltslnvkynndksrdytrpdlpsgdsqpsldq
    tmaaafg
    

  • Chain 'B':
    No sequence available.