PDB entry 2ada

View 2ada on RCSB PDB site
Description: atomic structure of adenosine deaminase complexed with a transition-state analog: understanding catalysis and immunodeficiency mutations
Class: hydrolase (amino)
Keywords: hydrolase (amino)
Deposited on 1994-12-02, released 1995-03-31
The last revision prior to the SCOP 1.75 freeze date was dated 1995-03-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.195
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenosine deaminase
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2adaa_
  • Heterogens: ZN, HPR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2adaA (A:)
    maqtpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpg
    flakfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqt
    egdvtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvam
    dlagdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgy
    htiedealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplif
    kstldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2adaA (A:)
    tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla
    kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd
    vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla
    gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgyhti
    edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplifkst
    ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq