PDB entry 2ada

View 2ada on RCSB PDB site
Description: atomic structure of adenosine deaminase complexed with a transition-state analog: understanding catalysis and immunodeficiency mutations
Deposited on 1994-12-02, released 1995-03-31
The last revision prior to the SCOP 1.65 freeze date was dated 1995-03-31, with a file datestamp of 1995-03-26.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.195
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d2ada__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >2ada_ (-)
    maqtpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpg
    flakfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqt
    egdvtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvam
    dlagdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgy
    htiedealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplif
    kstldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ada_ (-)
    tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla
    kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd
    vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla
    gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgyhti
    edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplifkst
    ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq