PDB entry 2ad6

View 2ad6 on RCSB PDB site
Description: crystal structure of methanol dehydrogenase from M. W3A1 (form C)
Class: Oxidoreductase
Keywords: methanol dehydrogenase, PQQ configuration, native
Deposited on 2005-07-20, released 2006-07-25
The last revision prior to the SCOP 1.73 freeze date was dated 2006-07-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.156
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methanol dehydrogenase subunit 1
    Species: Methylophilus methylotrophus W3A1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ad6a1
  • Chain 'B':
    Compound: methanol dehydrogenase subunit 2
    Species: Methylophilus methylotrophus W3A1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ad6b1
  • Chain 'C':
    Compound: methanol dehydrogenase subunit 1
    Species: Methylophilus methylotrophus W3A1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ad6c1
  • Chain 'D':
    Compound: methanol dehydrogenase subunit 2
    Species: Methylophilus methylotrophus W3A1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ad6d1
  • Heterogens: CA, PQQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ad6A (A:)
    dadldkqvntagawpiatggyysqhnsplaqinksnvknvkaawsfstgvlnghegaplv
    igdmmyvhsafpnntyalnlndpgkivwqhkpkqdastkavmccdvvdrglaygagqivk
    kqanghllaldaktgkinwevevcdpkvgstltqapfvakdtvlmgcsgaelgvrgavna
    fdlktgelkwrafatgsddsvrlakdfnsanphygqfglgtktwegdawkigggtnwgwy
    aydpklnlfyygsgnpapwnetmrpgdnkwtmtiwgrdldtgmakwgyqktphdewdfag
    vnqmvltdqpvngkmtpllshidrngilytlnrengnlivaekvdpavnvfkkvdlktgt
    pvrdpefatrmdhkgtnicpsamgfhnqgvdsydpesrtlyaglnhicmdwepfmlpyra
    gqffvgatlamypgpngptkkemgqirafdlttgkakwtkwekfaawggtlytkgglvwy
    atldgylkaldnkdgkelwnfkmpsggigspmtysfkgkqyigsmygvggwpgvglvfdl
    tdpsaglgavgafrelqnhtqmggglmvfsl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ad6B (B:)
    ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrianaks
    sgnfvfdvk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ad6C (C:)
    dadldkqvntagawpiatggyysqhnsplaqinksnvknvkaawsfstgvlnghegaplv
    igdmmyvhsafpnntyalnlndpgkivwqhkpkqdastkavmccdvvdrglaygagqivk
    kqanghllaldaktgkinwevevcdpkvgstltqapfvakdtvlmgcsgaelgvrgavna
    fdlktgelkwrafatgsddsvrlakdfnsanphygqfglgtktwegdawkigggtnwgwy
    aydpklnlfyygsgnpapwnetmrpgdnkwtmtiwgrdldtgmakwgyqktphdewdfag
    vnqmvltdqpvngkmtpllshidrngilytlnrengnlivaekvdpavnvfkkvdlktgt
    pvrdpefatrmdhkgtnicpsamgfhnqgvdsydpesrtlyaglnhicmdwepfmlpyra
    gqffvgatlamypgpngptkkemgqirafdlttgkakwtkwekfaawggtlytkgglvwy
    atldgylkaldnkdgkelwnfkmpsggigspmtysfkgkqyigsmygvggwpgvglvfdl
    tdpsaglgavgafrelqnhtqmggglmvfsl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ad6D (D:)
    ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrianaks
    sgnfvfdvk