PDB entry 2acy

View 2acy on RCSB PDB site
Description: acyl-phosphatase (common type) from bovine testis
Class: acylphosphatase
Keywords: acylphosphatase, phosphoric monoester hydrolase
Deposited on 1996-11-08, released 1997-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.17
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: acylphosphatase
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41500 (0-97)
  Domains in SCOPe 2.07: d2acya_
• Heterogens: SO4, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2acyA (A:)
  aegdtlisvdyeifgkvqgvffrkytqaegkklglvgwvqntdqgtvqgqlqgpaskvrh
  mqewletkgspkshidrasfhnekvivkldytdfqivk