PDB entry 2acy

View 2acy on RCSB PDB site
Description: acyl-phosphatase (common type) from bovine testis
Class: acylphosphatase
Keywords: acylphosphatase, phosphoric monoester hydrolase
Deposited on 1996-11-08, released 1997-11-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.17
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acylphosphatase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2acya_
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2acyA (A:)
    aegdtlisvdyeifgkvqgvffrkytqaegkklglvgwvqntdqgtvqgqlqgpaskvrh
    mqewletkgspkshidrasfhnekvivkldytdfqivk