PDB entry 2acp

View 2acp on RCSB PDB site
Description: Crystal structure of nitrophorin 2 aqua complex
Class: transport protein
Keywords: beta barrel, lipocalin, ferrous heme, TRANSPORT PROTEIN
Deposited on 2005-07-19, released 2006-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.187
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Nitrophorin 2
    Species: Rhodnius prolixus [TaxId:13249]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26241 (1-179)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d2acpx2, d2acpx3
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2acpX (X:)
    mdcstnispkqgldkakyfsgkwyvthfldkdpqvtdqycssftpresdgtvkealyhyn
    ankktsfynigegklessglqytakyktvdkkkavlkeadeknsytltvleaddssalvh
    iclregskdlgdlytvlthqkdaepsakvksavtqaglqlsqfvgtkdlgcqyddqftsl