PDB entry 2acj

View 2acj on RCSB PDB site
Description: Crystal structure of the B/Z junction containing DNA bound to Z-DNA binding proteins
Class: hydrolase/DNA
Keywords: a B-Z juction, Protein-DNA complex, hydrolase-DNA COMPLEX
Deposited on 2005-07-19, released 2005-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.243
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Double-stranded RNA-specific adenosine deaminase
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55265 (3-End)
      • cloning artifact (1-2)
    Domains in SCOPe 2.07: d2acja1, d2acja2
  • Chain 'B':
    Compound: Double-stranded RNA-specific adenosine deaminase
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55265 (3-65)
      • cloning artifact (1-2)
    Domains in SCOPe 2.07: d2acjb1, d2acjb2
  • Chain 'C':
    Compound: Double-stranded RNA-specific adenosine deaminase
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55265 (3-65)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d2acjc1, d2acjc2
  • Chain 'D':
    Compound: Double-stranded RNA-specific adenosine deaminase
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55265 (3-End)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d2acjd1, d2acjd2
  • Chain 'E':
    Compound: 5'-d(*gp*tp*cp*gp*cp*gp*cp*gp*cp*cp*ap*tp*ap*ap*ap*cp*c)-3'
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: 5'-d(*ap*cp*gp*gp*tp*tp*tp*ap*tp*gp*gp*cp*gp*cp*gp*cp*g)-3'
    Species: synthetic, synthetic

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2acjA (A:)
    shmeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpplwk
    iavstq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2acjA (A:)
    hmeqrilkfttahdlsgklgtpkkeinrvlyslakkgklqkeagtpplwkiav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2acjB (B:)
    shmeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpplwk
    iavstq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2acjB (B:)
    hmeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpplwki
    avstq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2acjC (C:)
    shmeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpplwk
    iavstq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2acjD (D:)
    shmeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpplwk
    iavstq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2acjD (D:)
    shmeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpplwk
    iav
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.