PDB entry 2aci

View 2aci on RCSB PDB site
Description: Structure of D166A arginine deiminase
Class: hydrolase
Keywords: arginine degradation pathway, L-arginine deiminase, X-ray structure, catalytic mechanism
Deposited on 2005-07-18, released 2005-08-09
The last revision prior to the SCOP 1.73 freeze date was dated 2005-10-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arginine deiminase
    Species: PSEUDOMONAS AERUGINOSA
    Gene: arcA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13981
      • engineered (165)
    Domains in SCOP 1.73: d2acia1
  • Chain 'B':
    Compound: Arginine deiminase
    Species: PSEUDOMONAS AERUGINOSA
    Gene: arcA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13981 (Start-417)
      • engineered (165)
    Domains in SCOP 1.73: d2acib1
  • Chain 'C':
    Compound: Arginine deiminase
    Species: PSEUDOMONAS AERUGINOSA
    Gene: arcA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13981
      • engineered (165)
    Domains in SCOP 1.73: d2acic1
  • Chain 'D':
    Compound: Arginine deiminase
    Species: PSEUDOMONAS AERUGINOSA
    Gene: arcA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13981 (Start-417)
      • engineered (165)
    Domains in SCOP 1.73: d2acid1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aciA (A:)
    mstektklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvt
    kmrergidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprkla
    eyliggvaaddlpaseganilkmyreylghssfllpplpntqftrattcwiyggvtlnpm
    ywparrqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligm
    gerssrqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpevvke
    ivpfslrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnn
    vvclepgvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpidy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aciA (A:)
    tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
    gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
    gvaaddlpaseganilkmyreylghssfllpplpntqftrattcwiyggvtlnpmywpar
    rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
    rqaigqvaqslfakgaaervivaglpkamhldtvfsfcdrdlvtvfpevvkeivpfslrp
    dpsspygmnirreektflevvaeslglkklrvvetgreqwddgnnvvclepgvvvgydrn
    tytntllrkagvevitisaselgrgrggghcmtcpivrdpid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aciB (B:)
    mstektklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvt
    kmrergidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprkla
    eyliggvaaddlpaseganilkmyreylghssfllpplpntqftrattcwiyggvtlnpm
    ywparrqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligm
    gerssrqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpevvke
    ivpfslrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnn
    vvclepgvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpidy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aciB (B:)
    tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
    gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
    gvaaddlpaseganilkmyreylghssfllpplpntqftrattcwiyggvtlnpmywpar
    rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
    rqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpevvkeivpfs
    lrpdpsspygmnirreektflevvaeslglkklrvvetgaaereqwddgnnvvclepgvv
    vgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpidy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2aciC (C:)
    mstektklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvt
    kmrergidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprkla
    eyliggvaaddlpaseganilkmyreylghssfllpplpntqftrattcwiyggvtlnpm
    ywparrqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligm
    gerssrqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpevvke
    ivpfslrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnn
    vvclepgvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpidy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aciC (C:)
    klgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrerg
    idvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeyligg
    vaaddlpaseganilkmyreylghssfllpplpntqftrattcwiyggvtlnpmywparr
    qetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerssr
    qaigqvaqslfakgaaervivaglpksamhldtvfsfcdrdlvtvfpevvkeivpfslrp
    dpsspygmnirreektflevvaeslglkklrvvetgereqwddgnnvvclepgvvvgydr
    ntytntllrkagvevitisaselgrgrggghcmtcpivrdpid
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2aciD (D:)
    mstektklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvt
    kmrergidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprkla
    eyliggvaaddlpaseganilkmyreylghssfllpplpntqftrattcwiyggvtlnpm
    ywparrqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligm
    gerssrqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpevvke
    ivpfslrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnn
    vvclepgvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpidy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aciD (D:)
    tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
    gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
    gvaaddlpaseganilkmyreylghssfllpplpntqftrattcwiyggvtlnpmywpar
    rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
    rqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpevvkeivpfs
    lrpdpsspygmnirreektflevvaeslglkklrvvetgreqwddgnnvvclepgvvvgy
    drntytntllrkagvevitisaselgrgrggghcmtcpivrdpidy