PDB entry 2ach

View 2ach on RCSB PDB site
Description:
Deposited on 1993-04-26, released 1993-07-15
The last revision prior to the SCOP 1.55 freeze date was dated 1993-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.7 Å
R-factor: 0.181
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d2ach.1
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d2ach.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2achA (A:)
    lglasanvdfafslykqlvlkapdknvifsplsistalaflslgahnttlteilkglkfn
    ltetseaeihqsfqhllrtlnqssdelqlsmgnamfvkeqlslldrftedakrlygseaf
    atdfqdsaaakklindyvkngtrgkitdlikdldsqtmmvlvnyiffkakwempfdpqdt
    hqsrfylskkkwvmvpmmslhhltipyfrdeelsctvvelkytgnasalfilpdqdkmee
    veamllpetlkrwrdslefreigelylpkfsisrdynlndillqlgieeaftskadlsgi
    tgarnlavsqvvhkavldvfeegteasaatavkitll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2achB (B:)
    trtivrfnrpflmiivptdtqniffmskvtnpkqa