PDB entry 2acg

View 2acg on RCSB PDB site
Description: acanthamoeba castellanii profilin II
Class: contractile protein
Keywords: protein binding, profilin, actin-binding protein, contractile protein
Deposited on 1994-08-30, released 1994-11-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.182
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: profilin II
    Species: Acanthamoeba castellanii [TaxId:5755]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2acga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2acgA (A:)
    swqtyvdtnlvgtgavtqaaiighdgntwatsagfavspangaalanafkdatairsngf
    elagtryvtiraddrsvygkkgsagvitvktskailigvynekiqpgtaanvvekladyl
    igqgf