PDB entry 2ac3

View 2ac3 on RCSB PDB site
Description: Structure of human Mnk2 Kinase Domain
Class: transferase
Keywords: DFD motif, TRANSFERASE
Deposited on 2005-07-18, released 2005-10-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.217
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAP kinase-interacting serine/threonine kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HBH9 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d2ac3a1, d2ac3a2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ac3A (A:)
    gstdsfsgrfedvyqlqedvlgegaharvqtcinlitsqeyavkiiekqpghirsrvfre
    vemlyqcqghrnvlelieffeeedrfylvfekmrggsilshihkrrhfneleasvvvqdv
    asaldflhnkgiahrdlkpenilcehpnqvspvkicdfdlgsgiklngdcspistpellt
    pcgsaeymapevveafseeasiydkrcdlwslgvilyillsgyppfvgrcgsdcgwdrge
    acpacqnmlfesiqegkyefpdkdwahiscaakdliskllvrdakqrlsaaqvlqhpwvq
    gcapentlptpmvlqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ac3A (A:)
    gstdsfsgrfedvyqlqedvlgegaharvqtcinlitsqeyavkiiekqpghirsrvfre
    vemlyqcqghrnvlelieffeeedrfylvfekmrggsilshihkrrhfneleasvvvqdv
    asaldflhnkgiahrdlkpenilcehpnqvspvkicdfdlgscgsaeymapevveafsee
    asiydkrcdlwslgvilyillsgyppfvgrcgsdcgwacpacqnmlfesiqegkyefpdk
    dwahiscaakdliskllvrdakqrlsaaqvlqhpwvq