PDB entry 2ac2

View 2ac2 on RCSB PDB site
Description: Crystal structure of the Tyr13Phe mutant variant of Bacillus subtilis Ferrochelatase with Zn(2+) bound at the active site
Class: lyase
Keywords: rossman fold, pi-helix, lyase
Deposited on 2005-07-18, released 2005-09-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.21
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferrochelatase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: hemH, hemF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32396 (0-308)
      • engineered (11)
    Domains in SCOPe 2.01: d2ac2a_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ac2A (A:)
    srkkmgllvmafgtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqite
    qqahnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstfs
    vqsynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamlivs
    ahslpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltrd
    lfeqkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidala
    tvvlkklgr