PDB entry 2ac0

View 2ac0 on RCSB PDB site
Description: Structural Basis of DNA Recognition by p53 Tetramers (complex I)
Class: apoptosis/DNA
Keywords: Protein-DNA complex, APOPTOSIS-DNA COMPLEX
Deposited on 2005-07-18, released 2006-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ac0a_
  • Chain 'B':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ac0b_
  • Chain 'C':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ac0c_
  • Chain 'D':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ac0d_
  • Chain 'E':
    Compound: 5'-d(*cp*gp*gp*gp*cp*ap*tp*gp*cp*cp*cp*g)-3'
  • Chain 'F':
    Compound: 5'-d(*cp*gp*gp*gp*cp*ap*tp*gp*cp*cp*cp*g)-3'
  • Chain 'G':
    Compound: 5'-d(*cp*gp*gp*gp*cp*ap*tp*gp*cp*cp*cp*g)-3'
  • Chain 'H':
    Compound: 5'-d(*cp*gp*gp*gp*cp*ap*tp*gp*cp*cp*cp*g)-3'
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ac0A (A:)
    sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstppp
    gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfr
    hsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevr
    vcacpgrdrrteeenlrkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ac0A (A:)
    sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstppp
    gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfr
    hsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevr
    vcacpgrdrrteeenlrkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ac0B (B:)
    sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstppp
    gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfr
    hsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevr
    vcacpgrdrrteeenlrkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ac0B (B:)
    sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstppp
    gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfr
    hsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevr
    vcacpgrdrrteeenlrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ac0C (C:)
    sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstppp
    gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfr
    hsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevr
    vcacpgrdrrteeenlrkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ac0C (C:)
    svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
    rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
    vvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvc
    acpgrdrrteeenlr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ac0D (D:)
    sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstppp
    gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfr
    hsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevr
    vcacpgrdrrteeenlrkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ac0D (D:)
    svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
    rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
    vvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvc
    acpgrdrrteeenlrkkg
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.