PDB entry 2abz

View 2abz on RCSB PDB site
Description: Crystal structure of C19A/C43A mutant of leech carboxypeptidase inhibitor in complex with bovine carboxypeptidase A
Class: hydrolase/hydrolase inhibitor
Keywords: inhibitor-metallocarboxypeptidase complex, LCI mutant, oxidative folding intermediate analog, hydrolase/hydrolase inhibitor COMPLEX
Deposited on 2005-07-18, released 2006-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.19
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carboxypeptidase A1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00730
      • see remark 999 (227)
      • see remark 999 (304)
    Domains in SCOPe 2.06: d2abza_
  • Chain 'B':
    Compound: Carboxypeptidase A1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00730
      • see remark 999 (227)
      • see remark 999 (304)
    Domains in SCOPe 2.06: d2abzb_
  • Chain 'C':
    Compound: Metallocarboxypeptidase inhibitor
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81511
      • engineered (18)
      • engineered (42)
    Domains in SCOPe 2.06: d2abzc1
  • Chain 'D':
    Compound: Metallocarboxypeptidase inhibitor
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81511
      • engineered (42)
    Domains in SCOPe 2.06: d2abzd_
  • Chain 'E':
    Compound: Metallocarboxypeptidase inhibitor
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81511
      • engineered (18)
      • engineered (42)
    Domains in SCOPe 2.06: d2abze_
  • Chain 'F':
    Compound: Metallocarboxypeptidase inhibitor
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81511
      • engineered (18)
      • engineered (42)
    Domains in SCOPe 2.06: d2abzf_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2abzA (A:)
    arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
    sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnnly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2abzA (A:)
    tntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrpaiw
    idlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafthsqn
    rlwrktrsvslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksivdfvkdh
    gnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsykygsiitt
    iyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvltimehtv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2abzB (B:)
    arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
    sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnnly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2abzB (B:)
    stntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrpai
    widlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafthsq
    nrlwrktrsvtslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksivdfvk
    dhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsykygsii
    ttiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvltimeht
    v
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2abzC (C:)
    gshtpdesflcyqpdqvcaficrgaaplpsegecnphptapwaregavewvpystgqcrt
    tcipyve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2abzC (C:)
    pdesflcyqpdqvcaficrgaaplpsegecnphptapwaregavewvpystgqcrttcip
    yv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2abzD (D:)
    gshtpdesflcyqpdqvcaficrgaaplpsegecnphptapwaregavewvpystgqcrt
    tcipyve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2abzD (D:)
    tpdesflcydqvcficrgaaplpegecnphptapwastgqcrttci
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2abzE (E:)
    gshtpdesflcyqpdqvcaficrgaaplpsegecnphptapwaregavewvpystgqcrt
    tcipyve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2abzE (E:)
    desflcyqpdqvcaficrgaaplpsegecnphptapwaregavewvpytgqcrttcipyv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2abzF (F:)
    gshtpdesflcyqpdqvcaficrgaaplpsegecnphptapwaregavewvpystgqcrt
    tcipyve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2abzF (F:)
    tpdesflcyqpdqvcaficrgaaplpsegecnphptapwarvewvptgqcrttcipyv