PDB entry 2abx

View 2abx on RCSB PDB site
Description: the crystal structure of alpha-bungarotoxin at 2.5 angstroms resolution. relation to solution structure and binding to acetylcholine receptor
Class: postsynaptic neurotoxin
Keywords: postsynaptic neurotoxin
Deposited on 1986-02-19, released 1986-05-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.24
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-bungarotoxin
    Species: Bungarus multicinctus [TaxId:8616]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60615 (0-73)
      • conflict (8)
      • conflict (10)
      • conflict (66-67)
      • conflict (70-71)
    Domains in SCOPe 2.06: d2abxa_
  • Chain 'B':
    Compound: alpha-bungarotoxin
    Species: Bungarus multicinctus [TaxId:8616]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60615 (0-73)
      • conflict (8)
      • conflict (10)
      • conflict (66-67)
      • conflict (70-71)
    Domains in SCOPe 2.06: d2abxb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2abxA (A:)
    ivchttatipssavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
    stdkcnhppkrqpg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2abxB (B:)
    ivchttatipssavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
    stdkcnhppkrqpg