PDB entry 2abx

View 2abx on RCSB PDB site
Description: the crystal structure of alpha-bungarotoxin at 2.5 angstroms resolution. relation to solution structure and binding to acetylcholine receptor
Deposited on 1986-02-19, released 1986-05-07
The last revision prior to the SCOP 1.55 freeze date was dated 1987-10-16, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.24
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d2abxa_
  • Chain 'B':
    Domains in SCOP 1.55: d2abxb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2abxA (A:)
    ivchttatipssavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
    stdkcnhppkrqpg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2abxB (B:)
    ivchttatipssavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
    stdkcnhppkrqpg