PDB entry 2abw

View 2abw on RCSB PDB site
Description: Glutaminase subunit of the plasmodial PLP synthase (Vitamin B6 biosynthesis)
Class: transferase
Keywords: Glutaminase, PLP-synthase, Vitamin B6, malaria, TRANSFERASE
Deposited on 2005-07-17, released 2006-01-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pdx2 protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: Pdx2
    Database cross-references and differences (RAF-indexed):
    • GB CAI39217 (Start-218)
      • expression tag (219-220)
    Domains in SCOPe 2.08: d2abwa1, d2abwa2
  • Chain 'B':
    Compound: Pdx2 protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: Pdx2
    Database cross-references and differences (RAF-indexed):
    • GB CAI39217 (Start-218)
      • expression tag (219-226)
    Domains in SCOPe 2.08: d2abwb2, d2abwb3
  • Heterogens: PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2abwA (A:)
    mseitigvlslqgdfephinhfiklqipslniiqvrnvhdlglcdglvipggesttvrrc
    cayendtlynalvhfihvlkkpiwgtcagcillsknveniklysnfgnkfsfgglditic
    rnfygsqndsficslniisdssafkkdltaacirapyireilsdevkvlatfshesygpn
    iiaaveqnnclgtvfhpellphtafqqyfyekvknykyslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2abwA (A:)
    seitigvlslqgdfephinhfiklqipslniiqvrnvhdlglcdglvipggesttvrrcc
    ayendtlynalvhfihvlkkpiwgtcagcillsknveniklysnfgnkfsfgglditicr
    nfndsficslniisdssafkkdltaacirapyireilsdevkvlatfshesygpniiaav
    eqnnclgtvfhpellphtafqqyfyekvknykysle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2abwB (B:)
    mseitigvlslqgdfephinhfiklqipslniiqvrnvhdlglcdglvipggesttvrrc
    cayendtlynalvhfihvlkkpiwgtcagcillsknveniklysnfgnkfsfgglditic
    rnfygsqndsficslniisdssafkkdltaacirapyireilsdevkvlatfshesygpn
    iiaaveqnnclgtvfhpellphtafqqyfyekvknykyslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2abwB (B:)
    seitigvlslqgdfephinhfiklqipslniiqvrnvhdlglcdglvipggesttvrrcc
    ayendtlynalvhfihvlkkpiwgtcagcillsknveniklysnfgnkfsfgglditicr
    nfygsqndsficslniisdssafkkdltaacirapyireilsdevkvlatfshesygpni
    iaaveqnnclgtvfhpellphtafqqyfyekvknykyslehhhhhh