PDB entry 2abr

View 2abr on RCSB PDB site
Description: Structure of D280A arginine deiminase with L-arginine forming a S-alkylthiouronium reaction intermediate
Class: hydrolase
Keywords: arginine degradation pathway, L-arginine deiminase, X-ray structure, catalytic mechanism, HYDROLASE
Deposited on 2005-07-15, released 2005-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.214
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arginine deiminase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: arcA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13981
      • engineered (279)
      • modified residue (405)
    Domains in SCOPe 2.07: d2abra1
  • Chain 'B':
    Compound: Arginine deiminase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: arcA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13981
      • engineered (279)
      • modified residue (405)
    Domains in SCOPe 2.07: d2abrb_
  • Chain 'C':
    Compound: Arginine deiminase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: arcA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13981
      • engineered (279)
      • modified residue (405)
    Domains in SCOPe 2.07: d2abrc_
  • Chain 'D':
    Compound: Arginine deiminase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: arcA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13981
      • engineered (279)
      • modified residue (405)
    Domains in SCOPe 2.07: d2abrd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2abrA (A:)
    mstektklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvt
    kmrergidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprkla
    eyliggvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpm
    ywparrqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligm
    gerssrqaigqvaqslfakgaaervivaglpksraamhlatvfsfcdrdlvtvfpevvke
    ivpfslrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnn
    vvclepgvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpidy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2abrA (A:)
    tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
    gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
    gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
    rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
    rqaigqvaqslfakgaaervivaglpksmhlatvfsfcdrdlvtvfpevvkeivpfslrp
    dpsspygmnirreektflevvaeslglkklrvvetgreqwddgnnvvclepgvvvgydrn
    tytntllrkagvevitisaselgrgrggghcmtcpivrdpid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2abrB (B:)
    mstektklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvt
    kmrergidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprkla
    eyliggvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpm
    ywparrqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligm
    gerssrqaigqvaqslfakgaaervivaglpksraamhlatvfsfcdrdlvtvfpevvke
    ivpfslrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnn
    vvclepgvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpidy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2abrB (B:)
    tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
    gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
    gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
    rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
    rqaigqvaqslfakgaaervivaglpkaamhlatvfsfcdrdlvtvfpevvkeivpfslr
    pdpsspygmnirreektflevvaeslglkklrvvetgaaereqwddgnnvvclepgvvvg
    ydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpid
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2abrC (C:)
    mstektklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvt
    kmrergidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprkla
    eyliggvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpm
    ywparrqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligm
    gerssrqaigqvaqslfakgaaervivaglpksraamhlatvfsfcdrdlvtvfpevvke
    ivpfslrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnn
    vvclepgvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpidy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2abrC (C:)
    klgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrerg
    idvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeyligg
    vaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywparr
    qetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerssr
    qaigqvaqslfakgaaervivaglpksamhlatvfsfcdrdlvtvfpevvkeivpfslrp
    dpsspygmnirreektflevvaeslglkklrvvetgereqwddgnnvvclepgvvvgydr
    ntytntllrkagvevitisaselgrgrggghcmtcpivrdpid
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2abrD (D:)
    mstektklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvt
    kmrergidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprkla
    eyliggvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpm
    ywparrqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligm
    gerssrqaigqvaqslfakgaaervivaglpksraamhlatvfsfcdrdlvtvfpevvke
    ivpfslrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnn
    vvclepgvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpidy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2abrD (D:)
    tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
    gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
    gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
    rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
    rqaigqvaqslfakgaaervivaglpksrmhlatvfsfcdrdlvtvfpevvkeivpfslr
    pdpsspygmnirreektflevvaeslglkklrvvetgreqwddgnnvvclepgvvvgydr
    ntytntllrkagvevitisaselgrgrggghcmtcpivrdpi