PDB entry 2abl

View 2abl on RCSB PDB site
Description: sh3-sh2 domain fragment of human bcr-abl tyrosine kinase
Class: transferase
Keywords: transferase, tyrosine kinase, sh3, sh2, oncoprotein
Deposited on 1996-11-17, released 1997-09-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.183
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: abl tyrosine kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL SH3-SH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2abla1, d2abla2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ablA (A:)
    mgpsendpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsny
    itpvnslekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyr
    intasdgklyvssesrfntlaelvhhhstvadglittlhypap