PDB entry 2abl

View 2abl on RCSB PDB site
Description: sh3-sh2 domain fragment of human bcr-abl tyrosine kinase
Deposited on 1996-11-17, released 1997-09-04
The last revision prior to the SCOP 1.63 freeze date was dated 1997-09-04, with a file datestamp of 1997-09-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.183
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2abl_ (-)
mgpsendpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsny
itpvnslekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyr
intasdgklyvssesrfntlaelvhhhstvadglittlhypap