PDB entry 2abd

View 2abd on RCSB PDB site
Description: the three-dimensional structure of acyl-coenzyme a binding protein from bovine liver. structural refinement using heteronuclear multidimensional nmr spectroscopy
Class: acyl-coenzyme a binding protein
Keywords: acyl-coenzyme a binding protein
Deposited on 1993-03-05, released 1993-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: acyl-coenzyme a binding protein
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07107 (0-85)
  Domains in SCOPe 2.08: d2abda_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2abdA (A:)
  sqaefdkaaeevkhlktkpadeemlfiyshykqatvgdinterpgmldfkgkakwdawne
  lkgtskedamkayidkveelkkkygi