PDB entry 2ab6

View 2ab6 on RCSB PDB site
Description: HUMAN GLUTATHIONE S-TRANSFERASE M2-2 (E.C.2.5.1.18) complexed with S-METHYLGLUTATHIONE
Class: transferase
Keywords: transferase, s-methylglutathione, conjugation, detoxification
Deposited on 2005-07-14, released 2005-08-02
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.23
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase Mu 2
    Species: HOMO SAPIENS
    Gene: GSTM2, GST4
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ab6a1, d2ab6a2
  • Chain 'B':
    Compound: Glutathione S-transferase Mu 2
    Species: HOMO SAPIENS
    Gene: GSTM2, GST4
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ab6b1, d2ab6b2
  • Chain 'C':
    Compound: Glutathione S-transferase Mu 2
    Species: HOMO SAPIENS
    Gene: GSTM2, GST4
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ab6c1, d2ab6c2
  • Chain 'D':
    Compound: Glutathione S-transferase Mu 2
    Species: HOMO SAPIENS
    Gene: GSTM2, GST4
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ab6d1, d2ab6d2
  • Heterogens: GSM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ab6A (A:)
    pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgthkitqsnailryiarkhnlcgesekeqiredilenqfmdsrmqlaklcydpdfe
    klkpeylqalpemlklysqflgkqpwflgdkitfvdfiaydvlernqvfepscldafpnl
    kdfisrfeglekisaymkssrflprpvftkmavwgnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ab6B (B:)
    pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgthkitqsnailryiarkhnlcgesekeqiredilenqfmdsrmqlaklcydpdfe
    klkpeylqalpemlklysqflgkqpwflgdkitfvdfiaydvlernqvfepscldafpnl
    kdfisrfeglekisaymkssrflprpvftkmavwgnk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ab6C (C:)
    pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgthkitqsnailryiarkhnlcgesekeqiredilenqfmdsrmqlaklcydpdfe
    klkpeylqalpemlklysqflgkqpwflgdkitfvdfiaydvlernqvfepscldafpnl
    kdfisrfeglekisaymkssrflprpvftkmavwgnk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ab6D (D:)
    pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgthkitqsnailryiarkhnlcgesekeqiredilenqfmdsrmqlaklcydpdfe
    klkpeylqalpemlklysqflgkqpwflgdkitfvdfiaydvlernqvfepscldafpnl
    kdfisrfeglekisaymkssrflprpvftkmavwgnk