PDB entry 2ab1

View 2ab1 on RCSB PDB site
Description: X-Ray Structure of Gene Product from Homo Sapiens HS.95870
Class: structural genomics, unknown function
Keywords: HS.95870, DUF498, STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, Center for Eukaryotic Structural Genomics, CESG
Deposited on 2005-07-14, released 2005-07-26
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-09, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.197
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: HOMO SAPIENS
    Gene: HS.95870
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H7C9 (0-121)
      • cloning artifact (0)
      • modified residue (13)
      • modified residue (70)
    Domains in SCOP 1.73: d2ab1a1
  • Chain 'B':
    Compound: hypothetical protein
    Species: HOMO SAPIENS
    Gene: HS.95870
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H7C9 (0-121)
      • cloning artifact (0)
      • modified residue (13)
      • modified residue (70)
    Domains in SCOP 1.73: d2ab1b1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ab1A (A:)
stspeiaslswgqmkvkgsnttykdckvwpggsrtwdwretgtehspgvqpadvkevvek
gvqtlvigrgmsealkvpsstveylkkhgidvrvlqteqavkeynalvaqgvrvggvfhs
tc

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2ab1B (B:)
stspeiaslswgqmkvkgsnttykdckvwpggsrtwdwretgtehspgvqpadvkevvek
gvqtlvigrgmsealkvpsstveylkkhgidvrvlqteqavkeynalvaqgvrvggvfhs
tc

    Sequence, based on observed residues (ATOM records): (download) 
    >2ab1B (B:)
stspeiaslswgqmkvkgsnttykdckvwpggsrtwdgvqpadvkevvekgvqtlvigrg
msealkvpsstveylkkhgidvrvlqteqavkeynalvaqgvrvggvfhstc