PDB entry 2aay

View 2aay on RCSB PDB site
Description: EPSP synthase liganded with shikimate and glyphosate
Class: Transferase
Keywords: inside-out alpha/beta barrel
Deposited on 2005-07-14, released 2006-02-14
The last revision prior to the SCOP 1.73 freeze date was dated 2006-02-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.156
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-phosphoshikimate 1-carboxyvinyltransferase
    Species: Escherichia coli
    Gene: aroA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2aaya1
  • Heterogens: SKM, GPJ, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aayA (A:)
    mesltlqpiarvdgtinlpgsksvsnralllaalahgktvltnlldsddvrhmlnaltal
    gvsytlsadrtrceiignggplhaegalelflgnagtamrplaaalclgsndivltgepr
    mkerpighlvdalrlggakityleqenypplrlqggftggnvdvdgsvssqfltallmta
    plapedtvirikgdlvskpyiditlnlmktfgveienqhyqqfvvkggqsyqspgtylve
    gdassasyflaaaaikggtvkvtgigrnsmqgdirfadvlekmgaticwgddyisctrge
    lnaidmdmnhipdaamtiataalfakgtttlrniynwrvketdrlfamatelrkvgaeve
    eghdyiritppeklnfaeiatyndhrmamcfslvalsdtpvtildpkctaktfpdyfeql
    arisqaa