PDB entry 2aav

View 2aav on RCSB PDB site
Description: Solution NMR structure of Filamin A domain 17
Class: protein binding
Keywords: Filamin A Domain 17, beta-sandwich, PROTEIN BINDING
Deposited on 2005-07-14, released 2006-05-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Filamin A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21333 (4-97)
      • cloning artifact (0-3)
    Domains in SCOPe 2.08: d2aava1, d2aava2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aavA (A:)
    gamvvncghvtaygpglthgvvnkpatftvntkdagegglslaiegpskaeisctdnqdg
    tcsvsylpvlpgdysilvkyneqhvpgspftarvtgdd