PDB entry 2aat

View 2aat on RCSB PDB site
Description: 2.8-angstroms-resolution crystal structure of an active-site mutant of aspartate aminotransferase from escherichia coli
Class: transferase(aminotransferase)
Keywords: transferase(aminotransferase)
Deposited on 1989-05-30, released 1989-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.22
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00509 (0-395)
      • engineered mutation (245)
    Domains in SCOPe 2.07: d2aata_
  • Heterogens: SO4, PMP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aatA (A:)
    mfenitaapadpilgladlfraderpgkinlgigvykdetgktpvltsvkkaeqyllene
    ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
    krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
    chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
    assysanfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsn
    dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
    lreefgvyavasgrvnvagmtpdnmaplceaivavl