PDB entry 2aar

View 2aar on RCSB PDB site
Description: Structure of trigger factor binding domain in biologically homologous complex with eubacterial ribosome.
Class: Ribosome
Keywords: Trigger Factor, 50S, ribosome, Cheperone, Tunnel
Deposited on 2005-07-14, released 2005-08-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.251
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: 23S ribosomal RNA
    Species: Deinococcus radiodurans [TaxId:1299]
  • Chain '7':
    Compound: Trigger Factor
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: 50S ribosomal protein L23
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2aarr1
  • Chain 'W':
    Compound: 50S ribosomal protein L29
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2aarw1

PDB Chain Sequences:

  • Chain '0':
    No sequence available.

  • Chain '7':
    No sequence available.

  • Chain 'R':
    Sequence, based on SEQRES records: (download) 
    >2aarR (R:)
mshydilqapvisekaysamergvysfwvspkatkteikdaiqqafgvrvigistmnvpg
krkrvgrfigqrndrkkaivrlaegqsiealagqa

    Sequence, based on observed residues (ATOM records): (download) 
    >2aarR (R:)
shydilqapvisekaysamergvysfwvspkatkteikdaiqqafgvrvigistmnvpgk
rkrvgrfigqrndrkkaivrlaegqsiealagq

  • Chain 'W':
    Sequence, based on SEQRES records: (download) 
    >2aarW (W:)
mkpsemrnlqatdfakeidarkkelmelrfqaaagqlaqphrvrqlrrevaqlntvkael
arkgeqq

    Sequence, based on observed residues (ATOM records): (download) 
    >2aarW (W:)
kpsemrnlqatdfakeidarkkelmelrfqaaagqlaqphrvrqlrrevaqlntvkaela
rkgeq