PDB entry 2aal

View 2aal on RCSB PDB site
Description: Crystal Structures of the Wild-type, Mutant-P1A and Inactivated Malonate Semialdehyde Decarboxylase: A Structural Basis for the Decarboxylase and Hydratase Activities
Class: lyase
Keywords: tautomerase superfamily; beta-alpha-beta; homotrimeric, LYASE
Deposited on 2005-07-13, released 2005-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.186
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Malonate Semialdehyde Decarboxylase
    Species: Pseudomonas pavonaceae [TaxId:47881]
    Gene: orf130
    Database cross-references and differences (RAF-indexed):
    • GB CAC11007 (1-129)
      • propionation (0)
      • conflict (7)
    Domains in SCOPe 2.07: d2aala1
  • Chain 'B':
    Compound: Malonate Semialdehyde Decarboxylase
    Species: Pseudomonas pavonaceae [TaxId:47881]
    Gene: orf130
    Database cross-references and differences (RAF-indexed):
    • GB CAC11007 (1-129)
      • propionation (0)
      • conflict (7)
      • cloning artifact (130)
    Domains in SCOPe 2.07: d2aalb2, d2aalb3
  • Chain 'C':
    Compound: Malonate Semialdehyde Decarboxylase
    Species: Pseudomonas pavonaceae [TaxId:47881]
    Gene: orf130
    Database cross-references and differences (RAF-indexed):
    • GB CAC11007 (1-129)
      • propionation (0)
      • conflict (7)
    Domains in SCOPe 2.07: d2aalc_
  • Chain 'D':
    Compound: Malonate Semialdehyde Decarboxylase
    Species: Pseudomonas pavonaceae [TaxId:47881]
    Gene: orf130
    Database cross-references and differences (RAF-indexed):
    • GB CAC11007 (1-129)
      • propionation (0)
      • conflict (7)
    Domains in SCOPe 2.07: d2aald_
  • Chain 'E':
    Compound: Malonate Semialdehyde Decarboxylase
    Species: Pseudomonas pavonaceae [TaxId:47881]
    Gene: orf130
    Database cross-references and differences (RAF-indexed):
    • GB CAC11007 (1-129)
      • propionation (0)
      • conflict (7)
    Domains in SCOPe 2.07: d2aale_
  • Chain 'F':
    Compound: Malonate Semialdehyde Decarboxylase
    Species: Pseudomonas pavonaceae [TaxId:47881]
    Gene: orf130
    Database cross-references and differences (RAF-indexed):
    • GB CAC11007 (1-129)
      • propionation (0)
      • conflict (7)
    Domains in SCOPe 2.07: d2aalf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aalA (A:)
    xpllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgy
    grssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrg
    raefltgdlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aalA (A:)
    xpllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgy
    grssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrg
    raefltgdlv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aalB (B:)
    xpllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgy
    grssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrg
    raefltgdlvg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2aalC (C:)
    xpllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgy
    grssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrg
    raefltgdlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aalC (C:)
    xpllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgy
    grssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrg
    raefltgdlv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2aalD (D:)
    xpllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgy
    grssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrg
    raefltgdlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aalD (D:)
    xpllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgy
    grssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrg
    raefltgdlv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2aalE (E:)
    xpllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgy
    grssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrg
    raefltgdlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aalE (E:)
    xpllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgy
    grssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrg
    raefltgdlv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2aalF (F:)
    xpllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgy
    grssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrg
    raefltgdlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aalF (F:)
    xpllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgy
    grssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrg
    raefltgdlv