PDB entry 2aak

View 2aak on RCSB PDB site
Description: ubiquitin conjugating enzyme from arabidopsis thaliana
Deposited on 1997-11-06, released 1998-03-18
The last revision prior to the SCOP 1.55 freeze date was dated 1998-03-18, with a file datestamp of 1998-03-18.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.221
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2aak__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2aak_ (-)
mstparkrlmrdfkrlqqdppagisgapqdnnimlwnavifgpddtpwdggtfklslqfs
edypnkpptvrfvsrmfhpniyadgsicldilqnqwspiydvaailtsiqsllcdpnpns
panseaarmyseskreynrrvrdvveqswt