PDB entry 2aaj

View 2aaj on RCSB PDB site
Description: Crystal Structures of the Wild-type, Mutant-P1A and Inactivated Malonate Semialdehyde Decarboxylase: A Structural Basis for the Decarboxylase and Hydratase Activities
Class: lyase
Keywords: tautomerase superfamily; beta-alpha-beta; homotrimeric, LYASE
Deposited on 2005-07-13, released 2005-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: 0.164
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Malonate Semialdehyde Decarboxylase
    Species: Pseudomonas pavonaceae [TaxId:47881]
    Gene: orf130
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EV83 (0-128)
      • engineered (0)
      • conflict (6)
      • conflict (77)
    Domains in SCOPe 2.07: d2aaja1
  • Chain 'B':
    Compound: Malonate Semialdehyde Decarboxylase
    Species: Pseudomonas pavonaceae [TaxId:47881]
    Gene: orf130
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EV83 (0-128)
      • engineered (0)
      • conflict (6)
      • conflict (77)
    Domains in SCOPe 2.07: d2aajb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aajA (A:)
    allkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgyg
    rssavvlltvisrprsesqkvcfyklltgalerdcgispddvivalvensdadwsfgrgr
    aefltgdlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aajA (A:)
    allkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgyg
    rssavvlltvisrprsesqkvcfyklltgalerdcgispddvivalvensdadwsfgrgr
    aefltgdlv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aajB (B:)
    allkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgyg
    rssavvlltvisrprsesqkvcfyklltgalerdcgispddvivalvensdadwsfgrgr
    aefltgdlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aajB (B:)
    allkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgyg
    rssavvlltvisrprsesqkvcfyklltgalerdcgispddvivalvensdadwsfgrgr
    aefltgdlv