PDB entry 2aag

View 2aag on RCSB PDB site
Description: Crystal Structures of the Wild-type, Mutant-P1A and Inactivated Malonate Semialdehyde Decarboxylase: A Structural Basis for the Decarboxylase and Hydratase Activities
Class: lyase
Keywords: tautomerase superfamily; beta-alpha-beta; homotrimeric, LYASE
Deposited on 2005-07-13, released 2005-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Malonate Semialdehyde Decarboxylase
    Species: Pseudomonas pavonaceae [TaxId:47881]
    Gene: orf130
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EV83 (0-128)
      • engineered (6)
    Domains in SCOPe 2.07: d2aaga_
  • Chain 'B':
    Compound: Malonate Semialdehyde Decarboxylase
    Species: Pseudomonas pavonaceae [TaxId:47881]
    Gene: orf130
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EV83 (0-128)
      • engineered (6)
      • cloning artifact (129)
    Domains in SCOPe 2.07: d2aagb2, d2aagb3
  • Chain 'C':
    Compound: Malonate Semialdehyde Decarboxylase
    Species: Pseudomonas pavonaceae [TaxId:47881]
    Gene: orf130
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EV83 (0-128)
      • engineered (6)
    Domains in SCOPe 2.07: d2aagc_
  • Chain 'D':
    Compound: Malonate Semialdehyde Decarboxylase
    Species: Pseudomonas pavonaceae [TaxId:47881]
    Gene: orf130
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EV83 (0-128)
      • engineered (6)
    Domains in SCOPe 2.07: d2aagd_
  • Chain 'E':
    Compound: Malonate Semialdehyde Decarboxylase
    Species: Pseudomonas pavonaceae [TaxId:47881]
    Gene: orf130
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EV83 (0-128)
      • engineered (6)
    Domains in SCOPe 2.07: d2aage_
  • Chain 'F':
    Compound: Malonate Semialdehyde Decarboxylase
    Species: Pseudomonas pavonaceae [TaxId:47881]
    Gene: orf130
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EV83 (0-128)
      • engineered (6)
    Domains in SCOPe 2.07: d2aagf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aagA (A:)
    pllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgyg
    rssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrgr
    aefltgdlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aagA (A:)
    pllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgyg
    rssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrgr
    aefltgdlv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aagB (B:)
    pllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgyg
    rssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrgr
    aefltgdlvg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2aagC (C:)
    pllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgyg
    rssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrgr
    aefltgdlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aagC (C:)
    pllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgyg
    rssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrgr
    aefltgdlv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2aagD (D:)
    pllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgyg
    rssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrgr
    aefltgdlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aagD (D:)
    pllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgyg
    rssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrgr
    aefltgdlv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2aagE (E:)
    pllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgyg
    rssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrgr
    aefltgdlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aagE (E:)
    pllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgyg
    rssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrgr
    aefltgdlv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2aagF (F:)
    pllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgyg
    rssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrgr
    aefltgdlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aagF (F:)
    pllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgyg
    rssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrgr
    aefltgdlv