PDB entry 2aaf

View 2aaf on RCSB PDB site
Description: Structure of H278A arginine deiminase with L-arginine forming a S-alkylthiouronium reaction intermediate
Class: hydrolase
Keywords: arginine degradation pathway, L-arginine deiminase, catalytic mechanism, hydrolase
Deposited on 2005-07-13, released 2005-08-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arginine deiminase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: arcA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13981
      • engineered (277)
      • modified residue (405)
    Domains in SCOPe 2.08: d2aafa1
  • Chain 'B':
    Compound: Arginine deiminase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: arcA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13981 (Start-417)
      • engineered (277)
      • modified residue (405)
    Domains in SCOPe 2.08: d2aafb_
  • Chain 'C':
    Compound: Arginine deiminase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: arcA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13981 (Start-417)
      • engineered (277)
      • modified residue (405)
    Domains in SCOPe 2.08: d2aafc_
  • Chain 'D':
    Compound: Arginine deiminase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: arcA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13981 (Start-417)
      • engineered (277)
      • modified residue (405)
    Domains in SCOPe 2.08: d2aafd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aafA (A:)
    mstektklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvt
    kmrergidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprkla
    eyliggvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpm
    ywparrqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligm
    gerssrqaigqvaqslfakgaaervivaglpksraamaldtvfsfcdrdlvtvfpevvke
    ivpfslrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnn
    vvclepgvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpidy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aafA (A:)
    tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
    gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
    gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
    rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
    rqaigqvaqslfakgaaervivaglpksraamaldtvfsfcdrdlvtvfpevvkeivpfs
    lrpdpsspygmnirreektflevvaeslglkklrvvetgreqwddgnnvvclepgvvvgy
    drntytntllrkagvevitisaselgrgrggghcmtcpivrdpid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aafB (B:)
    mstektklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvt
    kmrergidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprkla
    eyliggvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpm
    ywparrqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligm
    gerssrqaigqvaqslfakgaaervivaglpksraamaldtvfsfcdrdlvtvfpevvke
    ivpfslrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnn
    vvclepgvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpidy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aafB (B:)
    tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
    gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
    gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
    rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
    rqaigqvaqslfakgaaervivaglpksraamaldtvfsfcdrdlvtvfpevvkeivpfs
    lrpdpsspygmnirreektflevvaeslglkklrvvetgaaereqwddgnnvvclepgvv
    vgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpidy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2aafC (C:)
    mstektklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvt
    kmrergidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprkla
    eyliggvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpm
    ywparrqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligm
    gerssrqaigqvaqslfakgaaervivaglpksraamaldtvfsfcdrdlvtvfpevvke
    ivpfslrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnn
    vvclepgvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpidy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aafC (C:)
    klgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrerg
    idvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeyligg
    vaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywparr
    qetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerssr
    qaigqvaqslfakgaaervivaglpksraamaldtvfsfcdrdlvtvfpevvkeivpfsl
    rpdpsspygmnirreektflevvaeslglkklrvvetgereqwddgnnvvclepgvvvgy
    drntytntllrkagvevitisaselgrgrggghcmtcpivrdpidy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2aafD (D:)
    mstektklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvt
    kmrergidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprkla
    eyliggvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpm
    ywparrqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligm
    gerssrqaigqvaqslfakgaaervivaglpksraamaldtvfsfcdrdlvtvfpevvke
    ivpfslrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnn
    vvclepgvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpidy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aafD (D:)
    tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
    gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
    gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
    rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
    rqaigqvaqslfakgaaervivaglpksraamaldtvfsfcdrdlvtvfpevvkeivpfs
    lrpdpsspygmnirreektflevvaeslglkklrvvetgreqwddgnnvvclepgvvvgy
    drntytntllrkagvevitisaselgrgrggghcmtcpivrdpidy