PDB entry 2aae

View 2aae on RCSB PDB site
Description: the role of histidine-40 in ribonuclease t1 catalysis: three-dimensional structures of the partially active his40lys mutant
Class: hydrolase(endoribonuclease)
Keywords: hydrolase(endoribonuclease)
Deposited on 1992-09-15, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease t1
  Species: Aspergillus oryzae [TaxId:5062]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00651 (0-103)
    • conflict (24)
    • conflict (39)
  Domains in SCOPe 2.08: d2aaea_
• Heterogens: CA, PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2aaeA (A:)
  acdytcgsncysssdvstaqaagyklhedgetvgsnsypkkynnyegfdfsvsspyyewp
  ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect