PDB entry 2aad
View 2aad on RCSB PDB site
Description: the role of histidine-40 in ribonuclease t1 catalysis: three-dimensional structures of the partially active his40lys mutant
Class: hydrolase(endoribonuclease)
Keywords: hydrolase(endoribonuclease)
Deposited on
1992-09-15, released
1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-11-29, with a file datestamp of
2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ribonuclease t1 isozyme
Species: Aspergillus oryzae [TaxId:5062]
Database cross-references and differences (RAF-indexed):
- Uniprot P00651 (0-103)
- conflict (24)
- conflict (39)
Domains in SCOPe 2.08: d2aada_ - Chain 'B':
Compound: ribonuclease t1 isozyme
Species: Aspergillus oryzae [TaxId:5062]
Database cross-references and differences (RAF-indexed):
- Uniprot P00651 (0-103)
- conflict (24)
- conflict (39)
Domains in SCOPe 2.08: d2aadb_ - Heterogens: CA, 2GP, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2aadA (A:)
acdytcgsncysssdvstaqaagyklhedgetvgsnsypkkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2aadB (B:)
acdytcgsncysssdvstaqaagyklhedgetvgsnsypkkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect