PDB entry 2aab

View 2aab on RCSB PDB site
Description: Structural basis of antigen mimicry in a clinically relevant melanoma antigen system
Class: immune system
Keywords: Anti-idiotypic antibody, molecular mimicry, melanoma, immunotherapy, immune system
Deposited on 2005-07-13, released 2005-10-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.236
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: anti-idiotypic monoclonal antibody (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2AAB (0-End)
    Domains in SCOPe 2.06: d2aabh1
  • Chain 'L':
    Compound: anti-idiotypic monoclonal antibody (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2AAB (0-End)
    Domains in SCOPe 2.06: d2aabl1, d2aabl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2aabH (H:)
    dvqlvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissdssniyy
    adtvkgrftisrdnpkntlflqmtslrsedtamyycarsnyvgyhvrwyfdvwgagttvt
    vssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcgckpcictvpevssv
    fif
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aabH (H:)
    dvqlvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissdssniyy
    adtvkgrftisrdnpkntlflqmtslrsedtamyycarsnyvgyhvrwyfdvwgagttvt
    vssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2aabL (L:)
    diqltqspaslavslgqrvtiscrasesveyygsslmqwyqqkpgqppklliyaasnves
    gvparfsgsgsgtdfslnihpveeddiamyfcqqsrkipytfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aabL (L:)
    diqltqspaslavslgqrvtiscrasesveyygsslmqwyqqkpgqppklliyaasnves
    gvparfsgsgsgtdfslnihpveeddiamyfcqqsrkipytfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrge