PDB entry 2aab

View 2aab on RCSB PDB site
Description: Structural basis of antigen mimicry in a clinically relevant melanoma antigen system
Class: immune system
Keywords: Anti-idiotypic antibody, molecular mimicry, melanoma, immunotherapy
Deposited on 2005-07-13, released 2005-10-25
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.236
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: anti-idiotypic monoclonal antibody (heavy chain)
    Species: MUS MUSCULUS
    Domains in SCOP 1.73: d2aabh1
  • Chain 'L':
    Compound: anti-idiotypic monoclonal antibody (light chain)
    Species: MUS MUSCULUS
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2aabH (H:)
    dvqlvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissdssniyy
    adtvkgrftisrdnpkntlflqmtslrsedtamyycarsnyvgyhvrwyfdvwgagttvt
    vssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcgckpcictvpevssv
    fif
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aabH (H:)
    dvqlvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissdssniyy
    adtvkgrftisrdnpkntlflqmtslrsedtamyycarsnyvgyhvrwyfdvwgagttvt
    vssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    No sequence available.