PDB entry 2aaa

View 2aaa on RCSB PDB site
Description: calcium binding in alpha-amylases: an x-ray diffraction study at 2.1 angstroms resolution of two enzymes from aspergillus
Class: glycosidase
Keywords: glycosidase
Deposited on 1991-02-27, released 1993-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.169
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aaaa1, d2aaaa2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aaaA (A:)
    lsaaswrtqsiyflltdrfgrtdnsttatcntgneiycggswqgiidhldyiegmgftai
    wispiteqlpqdtadgeayhgywqqkiydvnsnfgtadnlkslsdalhargmylmvdvvp
    dhmgyagngndvdysvfdpfdsssyfhpyclitdwdnltmvedcwegdtivslpdldtte
    tavrtiwydwvadlvsnysvdglridsvlevqpdffpgynkasgvycvgeidngnpasdc
    pyqkvldgvlnypiywqllyafesssgsisnlynmiksvasdcsdptllgnfienhdnpr
    fakytsdysqaknvlsyiflsdgipivyageeqhyaggkvpynreatwlsgydtsaelyt
    wiattnairklaiaadsayityandafytdsntiamakgtsgsqvitvlsnkgssgssyt
    ltlsgsgytsgtklieaytctsvtvdssgdipvpmasglprvllpasvvdssslcggsgr
    lyve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aaaA (A:)
    lsaaswrtqsiyflltdrfgrtdnsttatcntgneiycggswqgiidhldyiegmgftai
    wispiteqlpqdtadgeayhgywqqkiydvnsnfgtadnlkslsdalhargmylmvdvvp
    dhmgyagngndvdysvfdpfdsssyfhpyclitdwdnltmvedcwegdtivslpdldtte
    tavrtiwydwvadlvsnysvdglridsvlevqpdffpgynkasgvycvgeidngnpasdc
    pyqkvldgvlnypiywqllyafesssgsisnlynmiksvasdcsdptllgnfienhdnpr
    fakytsdysqaknvlsyiflsdgipivyageeqhyaggkvpynreatwlsgydtsaelyt
    wiattnairklaiaadsayityandafytdsntiamakgtsgsqvitvlsnkgssgssyt
    ltlsgsgytsgtklieaytctsvtvdssgdipvpmasglprvllpasvvdssslcg